springer berlin heidelberg springer berlin heidelberg apr 1987 (75 resultados)

Taschenbuch. Condición: Neu. Neuware -This research monograph considers the subject of asymptotics from a nonstandard view point. It is intended both for classical asymptoticists - they will discover a new approach to problems very familiar to them - and for nonstandard analysts but includes topics of general interest, like the remarkable behaviour of Taylor polynomials of elementary functions. Noting that within nonstandard analysis, 'small', 'large', and 'domain of validity of asymptotic behaviour' have a precise meaning, a nonstandard alternative to classical asymptotics is developed. Special emphasis is given to applications in numerical approximation by convergent and divergent expansions: in the latter case a clear asymptotic answer is given to the problem of optimal approximation, which is valid for a large class of functions including many special functions. The author's approach is didactical. The book opens with a large introductory chapter which can be read without much knowledge of nonstandard analysis. Here the main features of the theory are presented via concrete examples, with many numerical and graphic illustrations. NSpringer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 204 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -The Notes give a direct approach to the Selberg zeta-function for cofinite discrete subgroups of SL (2,#3) acting on the upper half-plane. The basic idea is to compute the trace of the iterated resolvent kernel of the hyperbolic Laplacian in order to arrive at the logarithmic derivative of the Selberg zeta-function. Previous knowledge of the Selberg trace formula is not assumed. The theory is developed for arbitrary real weights and for arbitrary multiplier systems permitting an approach to known results on classical automorphic forms without the Riemann-Roch theorem. The author's discussion of the Selberg trace formula stresses the analogy with the Riemann zeta-function. For example, the canonical factorization theorem involves an analogue of the Euler constant. Finally the general Selberg trace formula is deduced easily from the properties of the Selberg zeta-function: this is similar to the procedure in analytic number theory where the explicit formulae are deduced from the properties of the Riemann zeta-function. Apart from the basic spectral theory of the Laplacian for cofinite groups the book is self-contained and will be useful as a quick approach to the Selberg zeta-function and the Selberg trace formula. 192 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -This second BiBoS volume surveys recent developments in the theory of stochastic processes. Particular attention is given to the interaction between mathematics and physics.Main topics include: statistical mechanics, stochastic mechanics, differential geometry, stochastic proesses, quantummechanics, quantum field theory, probability measures, central limit theorems, stochastic differential equations, Dirichlet forms.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 368 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -Osteoarticular pathology is a very frequent motive for consultation. Very often, the diagnosis relies upon symptomatology, and the physi cian requires confirmatory radiological investigations. Whatever the clinical indication, the interpretation of radiological data must be very rigorous. On the basis of a complete description of the radiographic images, according to a systematic analysis plan, a certain number of diagnostic hypotheses may be proposed. Selection of the most likely hypothesis requires the correlation of clinical, biological, and radiological data, and may sometimes necessi tate additional investigations, such as tomograms, scintigrams, and computed tomography (CT). 1 Part One Iconography 3 3 1 2 4 5 5 6 6 7 8 b a 8 a 9 10 11 12 10 13 14 11 15 a b 12 a c 13 17 b a c 14 15 c 16 17 23 21 a 22 b 18 19 20 21 22 23 33 34 24 25 37 38 26 27 40- 43 28 29 46 30 48 47 31 49 50 32 33 52 a b c 34 53 a b d c 35 54 a b 36 37 55 a 38 55 b c 39 56 57 40 58 41 60 61 42 43 63 64 44 65 66 45 67 68 46 69 a b 47 70 71 48 73 49 74 75 50 76 77 51 78 79 52 80 a b c 53 81 82 54 83 84 55 85 86 S6 87 88 57 89 90 58 91 92Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 180 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -Graph-theoretic concepts are developed by computer scientists in order to model algorithms, nets, rewriting systems, distributed systems, parallelism, geometric and layout concepts. Their complexity is studied under various randomness assumptions. This volume contains contributions to the twelfth of a series of annual workshops designed to bring together researchers using graph-theoretic methods. Its purpose is to broadcast emerging new developments from and to a diversity of application fields. The topics covered include: Graph Grammars, Graph Manipulation, Nets, Complexity Issues, Algorithmic and Network Considerations, Outerplanar Graphs, Graph Isomorphism, Parallelism and Distributed Systems, Graphs and Geometry, Randomness Considerations, Applications in Chemistry, Specific Algorithms. N 324 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -Homogeneous chaos revisited.- A propos des distributions sur l'espace de wiener.- Developpement des distributions suivant les chaos de wiener et applications a l'analyse stochastique.- Elements de probabilites quantiques.- Densite en temps petit d'un processus de sauts.- Construction de l'operateur de malliavin sur l'espace de poisson.- Inegalite de sobolev sup l'espace de poisson.- Etude des transformations de Riesz dans les vari¿s riemanniennes ¿ourbure de Ricci minor¿- A simple proof of the logarithmic sobolev inequality on the circle.- Temps local et superchamp.- Temps locaux et integration stochastique pour les processus de dirichlet.- L p inequalities for functionals of Brownian motion.- On the Barlow-Yor inequalities for local time.- A maximal inequality for martingale local times.- Inegalites pour les processus self-similaires arr¿s a un temps quelconque.- Limit distribution for 1-dimensional diffusion in a reflected Brownian medium.- Interpretation d'un calcul de H. Tanaka en theorie generale des processus.- Un processus qui ressemble au pont Brownien.- Tribus homogenes et commutation de projections.- Stationary excursions.- Stationary Markov sets.- Temps locaux d'intersection et points multiples des processus de levy.- Renormalisation et convergence en loi pour certaines integrales multiples associees au mouvement Brownien dans d.- Sur l'equivalent du module de continuite des processus de diffusion.- Repr¿ntation du champ de fluctuation de diffusions ind¿ndantes par le drap brownien.- L'approximation UCP et la continuite de certaines integrales stochastiques dependant d'un parametre.- Approximation of predictable characteristics of processes with filtrations.- Processus admettant un processus a accroissements independants tangent : Cas general.- Sur la methode de picard (edo et eds).- Equations differentielles stochastiques multivoques unidimensionnelles.- Convergence des approximations de mcshane d'une diffusion sur une variete compacte.- Topologie faible et meta-stabilite.- Une mesure d'information caracterisant la lot de poisson.- Slepian's inequality and commuting semigroups.- Corrections au S¿naire de Probabilit¿XX. 584 pp. Französisch.

Taschenbuch. Condición: Neu. Neuware -This book is intended as a textbook for a first course in applied statistics for students of economics, public administration and business administration. A limited knowledge of mathematics and - in one single chapter - some knowledge of elementary matrix algebra is required for understanding the text. Complicated mathematical proofs are avoided and the explanations are based on intuition and numerical examples. The aim of this book is to enable the student to understand the reasoning underlying a statistical analysis and to apply statistical methods to problems likely to be met within the fields of economics, public administration and business administration. The topics covered by the book are: - methods for exploratory data analysis - probability theory and standard statistical distributions - statistical inference theory - and three main areas of application: regression analysis, survey sampling and contingency tables. The treatment of exploratory data analysis, regression analysis and the analysis of contingency tables are based on the most recent theoretical developments in these areas. Most of the examples have never been presented before in English textbooks.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 452 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -Due to continual progress in the large-scale integration of semiconductor circuits, parallel computing principles can already be met in low-cost sys tems: numerous examples exist in image processing, for which special hard ware is implementable with quite modest resources even by nonprofessional designers. Principles of content addressing, if thoroughly understood, can thereby be applied effectively using standard components. On the other hand, mass storage based on associative principles still exists only in the long term plans of computer technologists. This situation is somewhat confused by the fact that certain expectations are held for the development of new storage media such as optical memories and 'spin glasses' (metal alloys with low-density magnetic impurities). Their technologies, however, may not ripen until after 'fifth generation' computers have been built. It seems that software methods for content addressing, especially those based on hash coding principles, are still holding their position firmly, and a few innovations have been developed recently. As they need no special hardware, one might expect that they will spread to a wide circle of users. This monograph is based on an extensive literature survey, most of which was published in the First Edition. I have added Chap. , which contains a review of more recent work. This updated book now has references to over 1200 original publications. In the editing of the new material, I received valuable help from Anneli HeimbUrger, M. Sc. , and Mrs. Leila Koivisto.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 404 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -Discusses the global evolution of the earth, such as coremantle separation, mantle-crust evolution, origin of oceanatmosphere system, on the basis of isotope earth science andpaleomagnetism, where recent devlopment in planetology andastrophysical theories are extensively taken into account.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 176 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -Bilinear forms and linear codes.- Efficient algorithms for the aperiodic convolution of sequences.- A new class of linear codes.- Error-detection and error-correction.- Automatic repeat request systems.- A generalized type-II hybrid ARQ scheme.- Conclusions.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 192 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -The investigation of special topics in systems dynamics -uncertain dynamic processes, viability theory, nonlinear dynamics in models for biomathematics, inverse problems in control systems theory-has become a major issue at the System and Decision Sciences Research Program of the International Insti tute for Applied Systems Analysis. The above topics actually reflect two different perspectives in the investigation of dynamic processes. The first, motivated by control theory, is concerned with the properties of dynamic systems that are stable under vari ations in the systems' parameters. This allows us to specify classes of dynamic systems for which it is possible to construct and control a whole 'tube' of trajectories assigned to a system with uncertain parameters and to resolve some inverse problems of control theory within numerically stable solution schemes. The second perspective is to investigate generic properties of dynamic systems that are due to nonlinearity (as bifurcations theory, chaotic behavior, stability properties, and related problems in the qualitative theory of differential systems). Special stress is given to the applications of non linear dynamic systems theory to biomathematics and ecoloey.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 228 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -InhaltsangabeI: Introduction.- 1: Overview and Summary.- II: Econometric Specifications of the Disequilibrium Model.- 2: Previous Specifications.- 2.1: The Standard Disequilibrium Specification.- 2.2: The Stochastic Min Specification.- 2.3: Explicit Aggregation.- 3: The Exact Excess Demand Specification.- 3.1: The Basic Model of Exact Excess Demand.- 3.2: Dynamic Links.- 3.3: An Endogenous Price.- 3.4: Testing for Equilibrium.- 3.5: Multiple Indicators.- 3.6: Extension to Multimarket Models.- 4: Evaluating the Exact Excess Demand Specification.- 4.1: A Likelihood Ratio Test of the Exact Indicator.- 4.2: Misspecification and Tractability of Estimation.- Appendix A: Linear Spillovers.- III: Estimation of a Single Market Disequilibrium Model.- 5: Model Structure - Labor Demand and Labor Supply.- 6: Excess Labor Demand Indicators.- 7: Estimation and Results.- 7.1: Exact Indicator Results.- 7.2: Testing the Exact Indicator.- Appendix B: Definition of Variables in Part III.- IV: Estimation of a Multimarret Disequilibrium Model.- 8: Model Structure I - Behavior of Agents.- 8.1: Household Behavior.- 8.2: Firm Behavior.- 9: Model Structure II - Market Interaction.- 9.1: Labor Market.- 9.2: Capital Goods Market.- 9.3: Consumer Goods Market.- 10: Excess Demand Indicators.- 10.1: Labor Market.- 10.2: Capital Goods Market.- 10.3: Consumer Goods Market.- 11: Estimation and Results.- Appendix C: International Trade.- Appendix D: Definition of Variables in Part IV.- V: Conclusion.- 12: Whither Disequilibrium .- References.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 144 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -Table Development and Rationale . . . . . . . . . . . . . . . 1 . . of Contents Stimulus Choice and Rationale . . 3 Administration . . . . . . . . . . . . . . . . . . . . . . . . 4 References . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Sample Data for Schizophrenics . . . . . . . . . . . . . . 6 Sample Data for Other Diagnostic Categories . . . . . . . 9 1 Projective tests have been valuable in personality assessment, Introduction diagnosis, and treatment by eliciting information about a per son's thinking, feelings, fantasies, interests, attitudes, and rela tionships with others. Picture-story methods such as Murray's Thematic Apperception Test (Murray et al. 1938), The Children's Apperception Test (Bellak and Bellak 1950), Van Lennep's Four Picture Test (1956), Pickford Projective Pictures (1963), The Object Relations Technique (Phillipson 1956), and Symonds Pic ture-Story Test (1948) have proven to be successful in revealing underlying personality dynamics. The Cognitive Synthesis Test (CST) appears to be an innovative and effective technique for evoking verbalizations by means of pictorial material. It offers the opportunity to study fantasy mate rial of psychotic and schizophrenic adolescents, as well as patients in other diagnostic categories.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 40 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -einzigartigen physikalischen und chemischen Eigenschaften diinner Schichten iiberhaupt erst moglich.

Taschenbuch. Condición: Neu. Neuware -On three occasions and at different locations, conferences were held to honor the eightieth birthday of Professor Herbert Frohlich: on the 18th December, 1985, in Liverpool, England; on the 14th February, 1986, in Stuttgart, Germany; and on the 8th March, 1986, on the Palm Coast, Florida. This Festschrift is a compilation of the papers of those conferences. Frohlich's choice of problems, from the earliest days, was couched in the phy sics of intrinsically interacting systems of excitation. One example, in which he set the course of research which is still followed, concerned dielectric breakdown, developed from the 1930's over several decades. The interacting systems are the electrons (receiving energy from an electric field) and lattice atom motion (taking energy from the electrons via 'electron-phonon' interaction, hence heat dissipa tion). There is a threshold field above which the latter cannot keep up with the former, and the combined system (electrons plus phonons) 'runs away'; that is to say, collectively it switches to a new state.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 368 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -In the past, technological as well as economic forces dominated the evolution of industrial structures: these factors have been treated extensively in numerous studies. However, another major factor which has begun to have a decisive influ ence on the performance of the chemical industry is technological risk and public and environmental health considerations, in particular those related to toxic and hazardous substances used in industrial production processes. The issues of con trolling process risk, waste streams, and potential environmental consequences of accidental or routine release of hazardous chemicals are rapidly gaining in impor tance vis CI vis narrow economic considerations, and are increasingly reflected in national and international legislation. In the context of several ongoing R&D projects aiming at the development of a new generation of tools for 'intelligent' decision support, two related problem areas that have been identified are: (i) Structuring the industry or plant for the minimum cost of production as well as least risk - e.g., toxicity of chemicals involved. In this multi-criteria framework, we seek to resolve the conflict between industrial structure or plant design established by economic considerations and the one shaped by environmental concerns. This can be formulated as a design problem for nor mal production conditions. In section 3.1. and 3.2. an approach on how to deal with this problem at the industry and plant level is discussed.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 468 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -These proceedings include papers presented at the VII-th Internatio nal Conference on Multiple Criteria Decision Making which was held in Kyoto/Japan on August 18-22, 1986. Multiple Criteria Decision Making (MCDM) has been a greatly import ant subject in many practical fields, for example, in planning, design, control and management in both private and public sectors. After remark able developments of theory, methodology and pilot case studies in rec ent years, it is now facing the stage of real applications and develop ment of more sophisticated methodology as interactive intelligent decision support systems. The conference aimed to provide a significant contribu tion to the future of MCDM as one of total systems including human factors: Substantial emphasis was given to knowledge engineering and cognitive sci ence. The conference inherits the tradition and the style of the previous conferences: (1) Jouy-en-Josas/France (1975), (2) Buffalo/U.S.A. (1977), (3) Konigswinter/FRG (1978), (4) Delaware/U.S.A. (1980), (5) Mons/Belgium (1982), (6) Cleveland/U.S.A. (1984). This time a great many Japanese com panies provided grants for the conference. As a result, the total number of participants was over 120, and a computer demonstration could be reali zed on an extensive scale as well as the conference sessions. Throughout the conference, it was observed that MCDM is making steady progress not only in theory but also as a tool for decision support.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 464 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -Many mammalian species living at medium or higher latitudes show marked annual cycles in various morphological and functional properties. There is a clear cycle of the reproductive activity ranging from a fertile to an infertile state in both the male and female. Such an annual periodicity can be regarded as an adaptation to seasonal changes of environmental conditions such as cli mate and nutrition, ensuring that birth and development of the litter are re stricted to a favorable season. These annual cycles consist of cyclic changes of exocrine and endocrine gonadal function, in the hormone-dependent organs (accessory glands, etc.) and in the hormonal hypothalamic-pituitary-gonadal system (for literature, see Hoffmann 1981). Such a seasonal cycle of reproductive activity was found in species from all vertebrate groups (i.e., birds, see Hoffmann 1981; Breucker 1982; reptiles, amphibians, and teleosts, see Hoffmann 1981). In those primate species of the Macaca family which are seasonal breeders (Zamboni et al. 1974), it was demonstrated by Richter et al. (1978) and Wickings and Nieschlag (1980) that these cycles are also evident under constant laboratory conditions, suggest ing that these cycles are based upon endogenous rhythms which are modulated and synchronized in the natural habitat by exogenous factors.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 88 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -The History of the TNM System The TNM System for the c1assification of malignant tumours was developed by Pierre Denoix (France) between the years 1943 1 and 1952. In 1950 the UICC appointed a Committee on Thmour Nomen clature and Statistics and adopted, as a basis for its work on clini cal stage c1assification, the general definitions of local extension of malignant tumours suggested by the World Health Organiza tion (WHO) Sub-Committee on The Registration of Cases of 2 Cancer as weIl as their Statistical Presentation. In 1953 the Committee held a joint meeting with the Interna tional Commission on Stage-Grouping in Cancer and Presenta tion of the Results of Treatment of Cancer appointed by the International Congress of Radiology. Agreement was reached on a general technique for c1assification by anatomical extent of dis ease, using the TNM system. In 1954 the Research Comrnission of the UICC set up a spe cial Committee on Clinical Stage Classification and Applied Statis ticsto 'pursue studies in this field and to extend the general tech nique of c1assification to cancer at aIl sites'. In 1958 the Committee published its first recommendations for the clinical stage classification of cancers of the breast and 1 Denoix, P.F.: BuH. Inst. Nat. Hyg. (Paris) 1: 1-69 (1944) and 5: 52-82 (1944). 216 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -According to Valentin (1833) and Luschka (1862), the first description of the structure now known as the carotid body must be ascribed to a Swiss physiolo gist - Albrecht von Haller - who, in 1762, called it the ganglion exiguum. This claim, however, may be erroneous, for Tauber (1743) described a struc ture at the bifurcation on the common carotid artery and called it the ganglion minutum. Andersch (1797) reprinted the text of a study made by his father between 1751 and 1755. The original printing of this work had apparently been sold as waste paper! Andersch called the organ the ganglion intercaroticum on account of its location. He also specifically stated that the sympathetic chain, the glossopharyngeal and the vagus nerves sent branches into the organ. For a while the carotid body remained forgotten, to be rediscovered in 1833 by Mayer of Bonn who again remarked upon the branches of the sympathetic, glossopharyngeal and vagus nerves as sources of a nerve plexus which innervated the ganglion intercaroticurtl. . Valentin (1833) clearly regarded the structure as part of the sympathetic nervous system, although he too recognised that the vagus and glossopharyngeal nerves contributed conspicuously to its innervation. Thus it is evident that the anatomists of the eighteenth and early nineteenth centuries regarded the structure in the carotid bifurcation as one of the many ganglia which are interspersed in the course of the sympathetic nervous system.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 104 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -The history of medicine is dotted with the episodic appearance of new discoveries, scientific breakthroughs, and the development of new schools of medicine, and each has contributed to the evolution of the art and science of the practice of medicine. The founding of osteopathic medicine by Andrew Taylor Still was one such event. The development of the craniosacral concept by William G.Suther land was another. Both of these giants of osteopathic medicine en countered the reluctance of their colleagues to accept his contribu tion. Both were able to overcome this reluctance and saw the acceptance of his contribution because of the fundamental anatom ical and physiological truth supporting the concept, and the prag matic fact that their therapeutic applications were successful. Both men attracted to them individuals desirous of learning a new diag nostic and therapeutic procedure. It is fortunate that these individu als have continued to promulgate the contribution to osteopathic medicine of their mentors.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 124 pp. Englisch.

Taschenbuch. Condición: Neu. Neuware -Mechanische und numerische Grundlagen der Methode werdendargestellt. Behandelt werden u.a. St{be, Balken, elastischeK|rper, die harmonischen undtransienten Schwingungen dieser Bauteile und die Kopplung mit finiten Elementen. Zahlreiche Beispiele. Einflu~matrizen f}r die Behandlung vonPlattenproblemen, Membran- und Scheiben- problemen und f}rdie Probleme elastischer K|rper.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 392 pp. Deutsch.

Taschenbuch. Condición: Neu. Neuware -Dieses Buch behandelt die Lehre von der konvektiven Wiirmeiibertragung in laminaren und turbulenten Stromungen sowie bei erzwungener und freier Konvek tion und setzt zugleich die 'Grundgesetze der Wiirmeiibertragung' von U. Grigull, H. Grober und S. Erk in einer Reihe fort, deren erster Band 'Wiirmeleitung' von U. Grigull und H. Sandner bearbeitet und 1979 erschienen ist. Der Band 'Stofflibertra gung' wurde von A. Mersmann verfaBt und ist 1986 erschienen, Das Buch wendet sich in erster Linie an Studierende der Fachrichtungen Maschinen-und Chemiein genieurwesen, Verfahrens- und Energietechnik sowie Elektrotechnik an einer Technischen Universitiit. Es werden keine iiber das Vordiplom hinausgehenden speziellen Vorkenntnisse vorausgesetzt; die verwendeten mathematischen Metho den werden, soweit wie erforderlich, ausfiihrlich erliiutert. Das Buch ist als Lehrbuch konzipiert und zum Gebrauch neben den Vorlesungen wie auch als Repetitorium vor Priifungen gedacht. Neben den reinen Grundlagen werden auch eine Reihe von Gebrauchsformeln angegeben. Dadurch sol1en in keiner Weise bekannte Nachschlagewerke wie z. B. der VDI-Wiirmeatlas ersetzt werden. Viel mehr solI dem Studierenden, aber auch dem in der Praxis tiitigen Ingenieur gezeigt werden, wie man zu diesen Gebrauchsformeln kommt, d. h. aufwelchen Annahmen ihre Herleitung beruht und wo die Grenzen ihrer Anwendbarkeit liegen. Das Buch ist in drei Teile gegliedert. 1m ersten Teil werden die Grundgleichungen der Thermofluiddynamik, insbesondere die allgemeinen Grundgleichungen, die Reynoldsschen Gleichungen fUr den turbulenten Austausch und die Grenzschicht gleichungen fUr den laminaren und turbulenten Transport hergeleitet.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 436 pp. Deutsch.

Taschenbuch. Condición: Neu. Neuware -Zur Sicherung der Wettbewerbsfahigkeit eines Unternehmens ist es erforderlich, daB die installierten Kapazitaten in der Pro duktion entsprechend der jeweiligen Marktsituation wirtschaft lich ausgelastet werden. Die Marktsituation ist gepragt durch eine zunehmende Typen- und Variantenvielfalt /1/ und durch ei ne standig sich andernde Nachfragemenge /2/ bei einem insge samt stagnierenden Markt. Insbesondere der Montagebereich als letzte Stufe im Produk tionsprozeB muB veranderten Bedingungen schnell anpaBbar sein. Eine mit dem Nachfrageverhalten synchronisierbare Montage ver meidet Lagerkosten fur Produkte in einer hohen Wertschopfungs stufe. Es ist daher anzustreben, Montagesysteme zu installie ren, die hinsichtlich der kapazitiven Auslastung flexibel be trieben werden konnen, so daB die technisch installierte Kapa zitat auch organisatorisch genutzt werden kann /3/. Bei der Konzeption von Montagesystemen stellt sich das Pro blem, die zu montierenden Produkte insgesamt einem System zu zuordnen oder sie auf mehrere Teilsysteme aufzuteilen. Es besteht das problem, daB einerseits bei der Montage unter schiedliche Produkte auf einem System die einzelnen Montageab schnitte bzw. Stationen nicht ~leichmaBig ausgelastet werden konnen und daB dadurch Kapazitatsverluste entstehen. Anderer seits fuhrt die Aufteilung eines Montagesysterns in Teilsysteme und deren spezifische Auslegung auf bestimrnte Produkte bei Nachfrageverschiebungen zur Unter- oder Uberlastung einzelner Teilsysterne. Die Problernstellung hat also eine rnengen- und ei ne ablaufbezogene Kornponente, die sich jeweils aus den Nach frageschwankungen bzw. aus dem Aufbau und Montageablauf der b~trachteten Produkte ergibt.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 164 pp. Deutsch.

Taschenbuch. Condición: Neu. Neuware -In diesem Buch versuche ich, möglichst leicht verständlich, die bei den heute existierenden Wirtschaftssysteme, das kapitalistisch-marktwirtschaftliche und das sozialistisch-planwirtschaftliche System, in ihren Grundzügen darzustellen und miteinander zu vergleichen. Auch wenn es mir zuerst einmal darum geht, die systembedingte Unterschiedlichkeit der wichtigsten Prozesse, aus welchen sich eine Wirtschaft zusammensetzt, möglichst objektiv näherzubringen, so wird diese Darstellung dennoch immer von meiner Bewertung der Systeme beeinflußt sein. Selbstverständlich geht es um die Bewertung von empirisch erfaßbaren Erschei nungen, die mit den Grundzügen dieses oder jenes Wirtschaftssystems inhärent verbunden sind. Meine Einstellung zu beiden Systemen geht davon aus, daß keine Wirtschafts bzw. Gesellschaftsordnung von ewiger Dauer ist. Während der geschichtlichen Entwicklung haben sich alle Gesellschaftssysteme verändert und zwar in der Weise, daß sich mehr oder weniger einzelne Systemgrundzüge verändert haben. Es ist meine Überzeugung, daß früher oder später auch verschiedene Grundzüge der heute existierenden Systeme eine Wandlung erfahren werden. Die Völker strebten immer - bewußt oder unbewußt - nach solchen Gesell schaftsänderungen, die sie von immer schwerer ertragbaren Leiden, von Ängsten, Unterdrückungen und Krisen befreien sollten. Manchmal dauerte es sehr lange, bevor sie einen richtigen Weg aus ihren Nöten fanden - oft irrten sie auch und folgten falschen Propheten. Trotz solcher Rückschläge setzte sich jedoch langfri stig eine fortschreitende Humanisierung der gesellschaftlichen Ordnungen durch.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 244 pp. Deutsch.

Taschenbuch. Condición: Neu. Neuware -Die vorliegende Arbeit entstand mit unterstUtzung des Fraunhofer-Instituts fUr Produktionstechnik und Automatisierung (IPA), Stuttgart. Mein besonderer Dank gilt dem Leiter des Instituts, Herrn Prof. Dr. -Ing. H. -J. Warnecke, fUr seine groBzUgige Forderung und die wertvollen Anregungen, die entscheidend zur erfolgreichen DurchfUhrung dieser Arbeit beigetragen haben. Herrn Prof. Dr. -Ing. G. Lechner danke ich fUr die uhernahme des Korreferats und die daraus resultieren den interessanten Hinweise und Gesprache. Besondere UnterstUtzung erfuhr ich von Herrn Dr. Abele, Abteilungsleiter am Institut fUr Produk tionstechnik und Automatisierung, sowie von zahl reichen Mitarbeitern des an der Entstehung der Arbeit beteiligten Industrieunternehmens. unter ihnen mochte ich Herrn Dr. Dausinger, Herrn Hagele, Herrn Reger, Herrn Dr. von Roda und Herrn Wilhelm besonders hervorheben. Ihnen allen gilt mein herzlicher Dank. Eberhard Rauschnabel Stuttgart, 1987 I N HAL T S V E R Z E I C H N I S Seite o AbkUrzungen und Formelzeichen 12 1 Einleitung 15 1. 1 prob1emste11ung und Zie1setzung 15 1. 2 Vorgehensweise 17 18 2 Ausgangssituation 2. 1 18 Begriffe und Definitionen 18 2. 1. 1 Verbindungsrohre 2. 1. 2 Abgrenzung der Begriffe 'Rohrverbindung', 'Rohransch1uB' und 'Ansch1uBsystem' 18 2. 1. 3 Montage 19 2. 1. 4 Abgrenzung der Montagefunktionen 'Handhaben' und 'FUgen' 19 2. 2 Stand der Technik 20 2. 2. 1 Rohrverbindungen fUr Kupferrohre 20 2. 2. 2 Automatisierungsgrad bei der Herste11ung von Rohransch1Ussen 22 24 3 Rohransch1uBsysterne 24 3. 1 Anforderungen an Rohrverbindungen 24 3. 1. 1 Funktionen 25 3. 1.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 128 pp. Deutsch.

Taschenbuch. Condición: Neu. Neuware -nur die Korrekturarbeiten auf unserem Textverarbeitungssystem übernahm, sondern mich stets mit großem Ver ständnis unterstützte.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 236 pp. Deutsch.

Taschenbuch. Condición: Neu. Neuware -Zementfreie Hüftprothese' vermittelte den aktuellen Stand der medizinischen Erkenntnisse auf diesem Gebiet.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 188 pp. Deutsch.

Taschenbuch. Condición: Neu. Neuware -Darstellung des Aufbaus des anorektalen Kontinenzorgans sowie der Physiologie von Kontinenz und Def{kation. Charakteristische Krankheitszeichen, detaillierte Untersuchungshinweise und allgemeine Richtlinien f}r die anorektale Chirurgie sind in Õbersichten zusammengefa~t. Die anorektalenKrankheiten (benigne wie maligne) sind aufgef}hrt, undsystematisch werden jeweils Òtiologie, Pathogenese, Klinikund Therapie beschrieben. Erg{nzt wurde ein Kapitel }berColitis ulcerosa und Enteritis granulomatosa im Anorektalbereich.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 196 pp. Deutsch.

Taschenbuch. Condición: Neu. Neuware -Mit dem vorliegenden Band wird erstmalig die Herzkatheterpraxis aus der Sicht des im Labor besch{ftigten Assistenzpersonals dargestellt. Besonderer Wert wird dabei auf dieBeschreibung von Vorbereitung, Assistenz und Nachbereitungvon Herzkatheteruntersuchungen gelegt. Au~erdem werden dieGrundlagen f}r das Verst{ndnis und die Bedienung der notwendigen Ger{te vermittelt. Das Buch ist ein Nachschlagewerkf}r das im Herzkatheterlabor t{tige Assistenzpersonal, vermittelt aber auch allen interessierten Òrzten das Grundlagenwissen f}r die Herzkatheterpraxis.Springer Verlag GmbH, Tiergartenstr. 17, 69121 Heidelberg 136 pp. Deutsch.